PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000272838
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family NF-YB
Protein Properties Length: 260aa    MW: 27017.8 Da    PI: 5.8071
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000272838genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB185.15.5e-5825120297
          NF-YB   2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrelegek 97 
                    reqdrflPianvsrimkk+lPanakiskdaket+qecvsefisfvt+easdkcqrekrktingddllwa++tlGfe+yveplk+yl+kyre+egek
  MDP0000272838  25 REQDRFLPIANVSRIMKKALPANAKISKDAKETLQECVSEFISFVTGEASDKCQREKRKTINGDDLLWAMTTLGFEEYVEPLKIYLQKYREMEGEK 120
                    89********************************************************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.107.5E-5520125IPR009072Histone-fold
SuperFamilySSF471135.59E-4127131IPR009072Histone-fold
PfamPF008081.4E-273094IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006151.5E-215876No hitNo description
PROSITE patternPS0068506177IPR003956Transcription factor, NFYB/HAP3, conserved site
PRINTSPR006151.5E-217795No hitNo description
PRINTSPR006151.5E-2196114No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 260 aa     Download sequence    Send to blast
MADSDNDSGG PNDVSHGQSG ELSAREQDRF LPIANVSRIM KKALPANAKI SKDAKETLQE  60
CVSEFISFVT GEASDKCQRE KRKTINGDDL LWAMTTLGFE EYVEPLKIYL QKYREMEGEK  120
STMGGGGGGR EKDSSSGGGG AASGGGGGGG GGGGVSSGIS GDGYNGGYGG MVMMGHHNHH  180
QGHMYGSGGG YQQHHMGMGG GGVGKSGGSS GGGGASVVRW SIFLVFYLHV ERDLYGTEFT  240
AIMEARVTKD DELVPSQSSL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4g91_B1e-4825115292Transcription factor HapC (Eurofung)
4g92_B1e-4825115292Transcription factor HapC (Eurofung)
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAM4495022e-84AM449502.2 Vitis vinifera contig VV78X221419.5, whole genome shotgun sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008342237.10.0PREDICTED: nuclear transcription factor Y subunit B-3-like isoform X1
SwissprotO233102e-75NFYB3_ARATH; Nuclear transcription factor Y subunit B-3
TrEMBLD7UAG52e-82D7UAG5_VITVI; Putative uncharacterized protein
STRINGVIT_19s0015g00440.t016e-82(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF59134150
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G14540.16e-69nuclear factor Y, subunit B3